Iright
BRAND / VENDOR: Proteintech

Proteintech, 83958-3-RR, PEA15 Recombinant monoclonal antibody

CATALOG NUMBER: 83958-3-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The PEA15 (83958-3-RR) by Proteintech is a Recombinant antibody targeting PEA15 in IF/ICC, ELISA applications with reactivity to human samples 83958-3-RR targets PEA15 in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: A431 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Background Information Phosphoprotein Enriched in Astrocytes 15 kDa (PEA15), also known as PED-15, is a small, death effector-domain (DED)-containing protein that was recently demonstrated to inhibit tumor necrosis factor-α-induced apoptosis and to reverse the inhibition of integrin activation due to H-Ras. PEA15 is a 15 kDa protein that is highly expressed in the nervous system with particularly high levels in astrocytes and neurons of the hippocampus. PEA15 is a cytoplasmic protein that sits at an important junction in intracellular signalling and can regulate diverse cellular processes, such as proliferation and apoptosis, dependent upon stimulation. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag13782 Product name: Recombinant human PEA15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-130 aa of BC002426 Sequence: MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA Predict reactive species Full Name: phosphoprotein enriched in astrocytes 15 Calculated Molecular Weight: 130 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC002426 Gene Symbol: PEA15 Gene ID (NCBI): 8682 RRID: AB_3671536 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q15121 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924