Proteintech, 83979-5-RR, PNMT Recombinant monoclonal antibody

Size: 20ul / 100ul The PNMT (83979-5-RR) by Proteintech is a Recombinant antibody targeting PNMT in WB, ELISA applications with reactivity to human samples 83979-5-RR targets PNMT in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information PNMT (Phenylethanolamine N-methyltransferase) is the final enzyme in the catecholamine synthesizing cascade that converts noradrenaline to epinephrine by transferring a methyl group from S-adenosyl-L-methionine (SAM) to norepinephrine. PNMT is primarily found in the adrenal medulla, where it is responsible for the production of epinephrine. It is also present in certain areas of the brain, such as the amygdala and retina, where it may be involved in various neurophysiological functions (PMID: 17175506). Variations in the PNMT gene have been associated with Alzheimer's disease, hypertension, and other disorders (PMID: 2816488,.11514309). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag4098 Product name: Recombinant human PNMT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-282 aa of BC037246 Sequence: MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQELGRWLQEEPGAFNWSMYSQHACLIEGKGECWQDKERQLRARVKRVLPIDVHQPQPLGAGSPAPLPADALVSAFCLEAVSPDLASFQRALDHITTLLRPGGHLLLIGALEESWYLAGEARLTVVPVSEEEVREALVRSGYKVRDLRTYIMPAHLQTGVDDVKGVFFAWAQKVGL Predict reactive species Full Name: phenylethanolamine N-methyltransferase Calculated Molecular Weight: 282 aa, 31 kDa Observed Molecular Weight: 31 kDa GenBank Accession Number: BC037246 Gene Symbol: PNMT Gene ID (NCBI): 5409 RRID: AB_3671553 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P11086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.