{"product_id":"proteintech-84011-6-rr","title":"Proteintech, 84011-6-RR, ABR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ABR (84011-6-RR) by Proteintech is a Recombinant antibody targeting ABR in WB, ELISA applications with reactivity to human, mouse, rat samples\n84011-6-RR targets ABR in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, mouse brain tissue,  SW480 cells,  U-251 cells,  U-87 MG cells,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nABR (Active breakpoint cluster region-related protein) is the only protein known in humans and mice to share high homology with BCR (68% amino acid identity). BCR(Breakpoint cluster region) gene was originally identified due to its involvement in a specific chromosomal translocation that causes the development of chronic myeloid leukemia and a subset of acute lymphoblastic leukemia. The C-terminus is a GTPase-activating protein domain which stimulates GTP hydrolysis by RAC1, RAC2 and CDC42. (PMID: 17116687, PMID: 37507586)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag29522 Product name: Recombinant human ABR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-87 aa of NM_021962 Sequence: MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGK Predict reactive species\nFull Name: active BCR-related gene\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 97-100 kDa\nGenBank Accession Number: NM_021962\nGene Symbol: ABR\nGene ID (NCBI): 29\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q12979\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888686747817,"sku":"84011-6-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84011-6-rr","provider":"Iright","version":"1.0","type":"link"}