{"product_id":"proteintech-84012-5-rr","title":"Proteintech, 84012-5-RR, SP100 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SP100 (84012-5-RR) by Proteintech is a Recombinant antibody targeting SP100 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n84012-5-RR targets SP100 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSP100 nuclear antigen, belongs to the nuclear bodies(NBs), has a role in the control of gene expression. It contains a HSR domain, which is important for the nuclear body targeting as well as for the dimerization, and one PxVxL motif, which if required for interaction with chromoshadow domains. Sp100 is an acidic protein that exerts a highly aberrant electrophoretic mobility in SDS-polyacrylamide gel electrophoresis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35193 Product name: Recombinant human SP100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-300 aa of BC011562 Sequence: YKGFENVIHDKLPLQESEEEEREERSGLQLSLEQGTGENSFRSLTWPPSGSPSHAGTTPPENGLSEHPCETEQINAKRKDTTSDKDDSLGSQQTNEQCAQKAEPTESCEQIAVQVNNGDAGREMPCPLPCDEESPEAELHNHGIQINSCSVRLVDIKKEK Predict reactive species\nFull Name: SP100 nuclear antigen\nCalculated Molecular Weight: 879 aa, 100 kDa\nObserved Molecular Weight: 70-100 kDa, 110-140 kDa\nGenBank Accession Number: BC011562\nGene Symbol: SP100\nGene ID (NCBI): 6672\nRRID: AB_3671580\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P23497\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888518189225,"sku":"84012-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84012-5-rr","provider":"Iright","version":"1.0","type":"link"}