{"product_id":"proteintech-84044-1-rr","title":"Proteintech, 84044-1-RR, Caveolin-1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Caveolin-1 (84044-1-RR) by Proteintech is a Recombinant antibody targeting Caveolin-1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n84044-1-RR targets Caveolin-1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, A549 cells,  MDA-MB-231 cells\nPositive IHC detected in: human colon cancer tissue, human colon tissue,  human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCaveolin-1 (CAV1), a multifunctional protein, is the main constituent molecule of caveolae and represents a scaffolding molecule for several signaling molecules including epidermal growth factor receptor (PMID: 19641024). Several studies have implicated that a reduced expression of CAV1 was found in cancers including head and neck carcinoma (PMID: 19002186). However, other studies recognize CAV1 as a tumor promoter because CAV1 is overexpressed in various kinds of cancers, especially in oral cancer (PMID: 20558341). Recent study also show that CAV1 is involved in gastric Cancer (PMID: 25339030).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8049 Product name: Recombinant human Caveolin-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 11-179 aa of BC006432 Sequence: GHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI Predict reactive species\nFull Name: caveolin 1, caveolae protein, 22kDa\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC006432\nGene Symbol: CAV1\nGene ID (NCBI): 857\nRRID: AB_3671611\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q03135\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888599191721,"sku":"84044-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84044-1-rr","provider":"Iright","version":"1.0","type":"link"}