{"product_id":"proteintech-84059-5-rr","title":"Proteintech, 84059-5-RR, KLK3\/PSA Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe KLK3\/PSA (84059-5-RR) by Proteintech is a Recombinant antibody targeting KLK3\/PSA in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84059-5-RR targets KLK3\/PSA in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: LNCaP cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLK3 also known as Prostate-Specific Antigen (PSA), is a 33 kDa glycoprotein primarily synthesized by the epithelial cells of the prostate gland. Its main physiological function is to cleave seminogelins I and II in semen, leading to the liquefaction of the seminal coagulum and the release of motile sperm. It is under tight regulation by androgens via the androgen receptor (AR). Serum PSA levels are elevated in prostate cancer due to disruption of the glandular architecture, allowing more PSA to enter the bloodstream. It is used alongside digital rectal exam (DRE) for early detection. Although termed \"prostate-specific,\" PSA is not exclusively produced by the prostate. Very low levels can be produced in periurethral glands, breast tissue, and some other tissues. Its expression is highly abundant in prostatic tissue and seminal fluid.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0869 Product name: Recombinant Human KLK3\/PSA protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 18-261 aa of NM_001648.2 Sequence: APLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP Predict reactive species\nFull Name: kallikrein-related peptidase 3\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 30-34 kDa\nGenBank Accession Number: NM_001648.2\nGene Symbol: KLK3\nGene ID (NCBI): 354\nRRID: AB_3671627\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P07288-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888432763049,"sku":"84059-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84059-5-rr","provider":"Iright","version":"1.0","type":"link"}