{"product_id":"proteintech-84062-3-rr","title":"Proteintech, 84062-3-RR, LRRK2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LRRK2 (84062-3-RR) by Proteintech is a Recombinant antibody targeting LRRK2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n84062-3-RR targets LRRK2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, RAW 264.7 cells,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine-rich repeat kinase 2 (LRRK2) in humans is encoded by the PARK8\/LRRK2 gene. Genetic variations within the LRRK2 gene are linked to a number of diseases, including Parkinson's disease (PD), Crohn's disease and Hansen's disease. The most frequent pathogenic mutations reside in the ROC-COR GTPase (R1441G\/C\/H, Y1669C) and kinase domains (G2019S, I2020T), indicating important roles for both enzymatic domains in the pathogenicity of LRRK2-driven PD.  The G2019S mutation in the Leucine-rich repeat kinase-2 (LRRK2) protein is the most common pathogenic mutation, accounting for 1-6% of sporadic and 3-19% of familial PD. (PMID: 34991886,PMID: 30872638)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag33713 Product name: Recombinant human LRRK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2372-2527 aa of NM_198578 Sequence: VVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE* Predict reactive species\nFull Name: leucine-rich repeat kinase 2\nCalculated Molecular Weight: 286 kDa\nObserved Molecular Weight: 286 kDa\nGenBank Accession Number: NM_198578\nGene Symbol: LRRK2\nGene ID (NCBI): 120892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5S007\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888777744553,"sku":"84062-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84062-3-rr","provider":"Iright","version":"1.0","type":"link"}