{"product_id":"proteintech-84069-8-rr","title":"Proteintech, 84069-8-RR, CD138\/Syndecan-1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD138\/Syndecan-1 (84069-8-RR) by Proteintech is a Recombinant antibody targeting CD138\/Syndecan-1 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n84069-8-RR targets CD138\/Syndecan-1 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissue, human tonsillitis tissue,  mouse colon tissue,  mouse skin tissue,  rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:2000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD138, also named as Syndecan-1 (SDC1), is an integral membrane protein. It participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. It is a heparan sulfate proteoglycan expressed on the surface of, and actively shed by, myeloma cells. Altered syndecan-1 expression has been detected in several different tumor types. CD138 was regarded as a useful marker for labeling normal and neoplastic plasma cells and plasmacytoid lymphomas.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1221 Product name: Recombinant Mouse CD138\/Syndecan-1 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 23-252 aa of NM_011519.2 Sequence: QIVAVNVPPEDQDGSGDDSDNFSGSGTGALPDTLSRQTPSTWKDVWLLTATPTAPEPTSSNTETAFTSVLPAGEKPEEGEPVLHVEAEPGFTARDKEKEVTTRPRETVQLPITQRASTVRVTTAQAAVTSHPHGGMQPGLHETSAPTAPGQPDHQPPRVEGGGTSVIKEVVEDGTANQLPAGEGSGEQDFTFETSGENTAVAAVEPGLRNQPPVDEGATGASQSLLDRKE Predict reactive species\nFull Name: syndecan 1\nCalculated Molecular Weight: 33 kDa\nGenBank Accession Number: NM_011519.2\nGene Symbol: Sdc1\nGene ID (NCBI): 20969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P18828-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888718368937,"sku":"84069-8-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84069-8-rr","provider":"Iright","version":"1.0","type":"link"}