Proteintech, 84072-5-RR, Leptin Recombinant monoclonal antibody

Size: 20ul / 100ul The Leptin (84072-5-RR) by Proteintech is a Recombinant antibody targeting Leptin in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84072-5-RR targets Leptin in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: 3T3-L1 cells Positive FC (Intra) detected in: HeLa cells, HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Leptin is a product of the obese (ob) gene and, following synthesis and secretion from fat cells in white adipose tissue, binds to and activates its cognate receptor, the leptin receptor (LEP-R) (PMID: 34084149). Still, smaller quantities have been detected in other body tissues, including the brown adipose tissue (BAT), placenta, fetal tissue, stomach, muscles, bone marrow, teeth, and brain (PMID:7568067, PMID: 12086939). Leptin circulates in the blood in both free and protein-bound forms, where the free form of leptin is the biologically active form (PMID: 12086939). Leptin can enter the central nervous system (CNS) (in the area of the choroid plexus) by receptor-mediated transport (PMID: 29254602). Leptin secretion is higher in subcutaneous than in visceral adipose tissue (PMID: 11133069, PMID: 14726444). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg0834 Product name: Recombinant Human Leptin protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 22-167 aa of BC060830 Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC Predict reactive species Full Name: leptin Calculated Molecular Weight: 167 aa, 19 kDa GenBank Accession Number: BC060830 Gene Symbol: Leptin Gene ID (NCBI): 3952 RRID: AB_3671642 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P41159 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.