{"product_id":"proteintech-84102-5-rr","title":"Proteintech, 84102-5-RR, TSEN34 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe TSEN34 (84102-5-RR) by Proteintech is a Recombinant antibody targeting TSEN34 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84102-5-RR targets TSEN34 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, MCF-7 cells,  A431 cells,  A549 cells,  HeLa cells,  HCT 116 cells,  U2OS cells\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35120 Product name: Recombinant human TSEN34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-165 aa of BC020805 Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS Predict reactive species\nFull Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34-36 kDa\nGenBank Accession Number: BC020805\nGene Symbol: TSEN34\nGene ID (NCBI): 79042\nRRID: AB_3671667\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BSV6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888521728169,"sku":"84102-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84102-5-rr","provider":"Iright","version":"1.0","type":"link"}