{"product_id":"proteintech-84121-5-rr","title":"Proteintech, 84121-5-RR, ZNF350 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZNF350 (84121-5-RR) by Proteintech is a Recombinant antibody targeting ZNF350 in WB, FC (Intra), ELISA applications with reactivity to human samples\n84121-5-RR targets ZNF350 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells\nPositive FC (Intra) detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF350 (Zinc finger protein 350), also known as zinc-finger and BRCA1-interacting protein with a Kruppel-associated box (KRAB) domain (ZBRK1), is involved in the development of several human tumor types, including breast, colon, and cervical carcinomas. ZNF350 has been identified as a transcriptional suppressor that can either form complexes with other proteins or play a direct transcriptional suppressive role in a single-factor form (PMID: 30613364). Overexpression of ZBRK1 has the potential to inhibit cancer cell migration and suppress metastasis activity suggesting that ZBRK1 may behave as a metastasis suppressor (PMID: 19996286).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag23982 Product name: Recombinant human ZNF350 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 426-532 aa of BC009921 Sequence: REKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLANRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP Predict reactive species\nFull Name: zinc finger protein 350\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC009921\nGene Symbol: ZNF350\nGene ID (NCBI): 59348\nRRID: AB_3671683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9GZX5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888681963689,"sku":"84121-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84121-5-rr","provider":"Iright","version":"1.0","type":"link"}