{"product_id":"proteintech-84131-5-rr","title":"Proteintech, 84131-5-RR, EIF3F Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EIF3F (84131-5-RR) by Proteintech is a Recombinant antibody targeting EIF3F in WB, FC (Intra), ELISA applications with reactivity to human samples\n84131-5-RR targets EIF3F in WB, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HeLa cells,  Jurkat cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF3F (eukaryotic translation initiation factor 3 subunit F) is a protein that plays an important role in eukaryotic cells and is an integral part of the translation initiation factor 3(Eif3) complex. EIF3 is a complex of at least 10 distinct subunits and is the largest translation initiation factor in eukaryotes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34849 Product name: Recombinant human EIF3F protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-357 aa of BC000490 Sequence: SYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHNESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGRMSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQDALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIALNEKLVNL Predict reactive species\nFull Name: eukaryotic translation initiation factor 3, subunit F\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC000490\nGene Symbol: EIF3F\nGene ID (NCBI): 8665\nRRID: AB_3671690\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00303\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888612331689,"sku":"84131-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84131-5-rr","provider":"Iright","version":"1.0","type":"link"}