{"product_id":"proteintech-84133-5-rr","title":"Proteintech, 84133-5-RR, CFAP70 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CFAP70 (84133-5-RR) by Proteintech is a Recombinant antibody targeting CFAP70 in WB, ELISA applications with reactivity to human samples\n84133-5-RR targets CFAP70 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HaCaT cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCilia- and flagella-associated protein 70 (CFAP70), also known as TTC18, harbours eight tetratricopeptide repeats (TPRs) and bound tightly to the ciliary axoneme. CFAP70 is necessary to assemble spermatid flagella and could be used as a diagnostic target for male infertility with OAT in the clinic.CFAP70 is a novel regulatory component of the ODA in motile cilia and flagella, and that the N-terminus is important for its ciliary localization (PMID: 30158508).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35209 Product name: Recombinant human TTC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC032856 Sequence: MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSSFQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVPESFIPTGPGQNYMVGLQVPS Predict reactive species\nFull Name: tetratricopeptide repeat domain 18\nCalculated Molecular Weight: 126 kDa\nObserved Molecular Weight: 110 kDa, 128 kDa\nGenBank Accession Number: BC032856\nGene Symbol: TTC18\nGene ID (NCBI): 118491\nRRID: AB_3671691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q5T0N1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888725676201,"sku":"84133-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84133-5-rr","provider":"Iright","version":"1.0","type":"link"}