{"product_id":"proteintech-84139-4-rr","title":"Proteintech, 84139-4-RR, CD3EAP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD3EAP (84139-4-RR) by Proteintech is a Recombinant antibody targeting CD3EAP in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84139-4-RR targets CD3EAP in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, A431 cells,  HeLa cells,  K-562 cells,  HEK-293T cells,  NCI-H1299 cells,  HCT 116 cells\nPositive IF\/ICC detected in: A431 cells, A549 cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman RNA polymerase I (Pol I)-specific subunit, previously identified as ASE-1 and as CD3ɛ-associated signal transducer (CAST), CD3EAP is a 55 kDa nucleolar autoantigen that has an apparent molecular mass of 90 kDa (PMID: 11199923). CD3EAP\/hPAF49 contains a single tyrosine residue at position 82 (Tyr82), which is phosphorylated upon stimulation of the T-cell receptor. Western blot analysis detected CD3EAP at an apparent molecular mass of ~80-90 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35074 Product name: Recombinant human CD3EAP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-130 aa of BC038992 Sequence: MEEPQAGDAARFSCPPNFTAKPPASESPRFSLEALTGPDTELWLIQAPADFAPECFNGRHVPLSGSQIVKGKLAGKRHRYRVLSSCPQAGEATLLAPSTEAGGGLTCASAPQGTLRILEGPQQSLSGSPL Predict reactive species\nFull Name: CD3e molecule, epsilon associated protein\nCalculated Molecular Weight: 510 aa, 55 kDa\nObserved Molecular Weight: 80-90 kDa\nGenBank Accession Number: BC038992\nGene Symbol: CD3EAP\nGene ID (NCBI): 10849\nRRID: AB_3671699\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15446\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888602304681,"sku":"84139-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84139-4-rr","provider":"Iright","version":"1.0","type":"link"}