{"product_id":"proteintech-84142-1-rr","title":"Proteintech, 84142-1-RR, CD9 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD9 (84142-1-RR) by Proteintech is a Recombinant antibody targeting CD9 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n84142-1-RR targets CD9 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, human urine exosomes,  L02 cells,  HeLa cells,  human placenta tissue,  HEK-293 exosomes\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, which may be due to the difference in glycosylations (PMID: 8701996).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species\nFull Name: CD9 molecule\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: NM_001769.4\nGene Symbol: CD9\nGene ID (NCBI): 928\nRRID: AB_3671703\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P21926\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888403173545,"sku":"84142-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84142-1-rr","provider":"Iright","version":"1.0","type":"link"}