{"product_id":"proteintech-84161-3-rr","title":"Proteintech, 84161-3-RR, SYNGR1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe SYNGR1 (84161-3-RR) by Proteintech is a Recombinant antibody targeting SYNGR1 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n84161-3-RR targets SYNGR1 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, pig brain tissue,  rat brain tissue\nPositive IF-P detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSynaptogyrins are one of the most abundant vesicle components and are involved in the regulation of neurotransmitter release and synaptic plasticity. Synaptogyrins comprise a family of tyrosine-phosphorylated proteins with three isoforms: two neuronal forms (synaptogyrin-1 and -3) and one ubiquitous form (synaptogyrin-2). The synaptogyrin 1 (SYNGR1) can act as a regulator of Ca2+-dependent exocytosis. SYNGR1 protein mutations are associated with schizophrenia and are considered to be positional candidate genes for schizophrenia.(PMID: 10383386; 10595519; 14755516; 14732601; 17049558)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0685 Product name: Recombinant human SYNGR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC000731 Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP Predict reactive species\nFull Name: synaptogyrin 1\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC000731\nGene Symbol: SYNGR1\nGene ID (NCBI): 9145\nRRID: AB_3671723\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O43759\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888519106729,"sku":"84161-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84161-3-rr","provider":"Iright","version":"1.0","type":"link"}