Proteintech, 84196-3-RR, TMEM106B Recombinant monoclonal antibody

Size: 20ul / 100ul The TMEM106B (84196-3-RR) by Proteintech is a Recombinant antibody targeting TMEM106B in IHC, ELISA applications with reactivity to human, mouse samples 84196-3-RR targets TMEM106B in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression. TMEM106B can be showed as 31-55 kDa and 70-90 kDa (Glycosylated or Dimer) form in western blot test. (PMID: 27543298, 22895706, PMID: 23136129). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg4518 Product name: recombinant human TMEM106B protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 119-274 aa of BC033901 Sequence: RSIDVKYIGVKSAYVSYDVQKRTIYLNITNTLNITNNNYYSVEVENITAQVQFSKTVIGKARLNNITIIGPLDMKQIDYTVPTVIAEEMSYMYDFCTLISIKVHNIVLMMQVTVTTTYFGHSEQISQERYQYVDCGRNTTYQLGQSEYLNVLQPQQ Predict reactive species Full Name: transmembrane protein 106B Calculated Molecular Weight: 31 kDa GenBank Accession Number: BC033901 Gene Symbol: TMEM106B Gene ID (NCBI): 54664 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NUM4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.