{"product_id":"proteintech-84201-1-rr","title":"Proteintech, 84201-1-RR, MRPS18A Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MRPS18A (84201-1-RR) by Proteintech is a Recombinant antibody targeting MRPS18A in WB, ELISA applications with reactivity to human samples\n84201-1-RR targets MRPS18A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A549 cells,  HeLa cells,  L02 cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMRPS18A (Mitochondrial Ribosomal Protein S18A) is a protein coding gene. It encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The increased expression of MRPS18A in cancer cells is explained by the increased energy metabolism of cancer cells and may pave the way for new diagnostic and therapeutic avenues to be explored (PMID: 28056857).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9011 Product name: Recombinant human MRPS18A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-196 aa of BC010364 Sequence: MAALKALVSGCGRLLRGLLAGPAATSWSRLPARGFREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH Predict reactive species\nFull Name: mitochondrial ribosomal protein S18A\nCalculated Molecular Weight: 196 aa, 22 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC010364\nGene Symbol: MRPS18A\nGene ID (NCBI): 55168\nRRID: AB_3671757\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9NVS2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888650899625,"sku":"84201-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84201-1-rr","provider":"Iright","version":"1.0","type":"link"}