{"product_id":"proteintech-84230-5-rr","title":"Proteintech, 84230-5-RR, NPEPPS Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe NPEPPS (84230-5-RR) by Proteintech is a Recombinant antibody targeting NPEPPS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84230-5-RR targets NPEPPS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-29T cells,  MDCK cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNPEPPS, also known as PSA, is a member of the oxytocinase subfamily of the M1 aminopeptidase family. NPEPPS encodes puromycin-sensitive aminopeptidase, a zinc metallopeptidase that hydrolyzes amino acids from the N-terminus of its substrate. The protein has 2 isoforms and is located in the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag36035 Product name: Recombinant human NPEPPS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 711-919 aa of BC065294 Sequence: GKLGKAGHKATLEEARRRFKDHVEGKQILSADLRSPVYLTVLKHGDGTTLDIMLKLHKQADMQEEKNRIERVLGATLLPDLIQKVLTFALSEEVRPQDTVSVIGGVAGGSKHGRKAAWKFIKDNWEELYNRYQGGFLISRLIKLSVEGFAVDKMAGEVKAFFESHPAPSAERTIQQCCENILLNAAWLKRDAESIHQYLLQRKASPPTV Predict reactive species\nFull Name: aminopeptidase puromycin sensitive\nObserved Molecular Weight: 103 kda\nGenBank Accession Number: BC065294\nGene Symbol: NPEPPS\nGene ID (NCBI): 9520\nRRID: AB_3671784\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P55786\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888358314153,"sku":"84230-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84230-5-rr","provider":"Iright","version":"1.0","type":"link"}