{"product_id":"proteintech-84287-3-rr","title":"Proteintech, 84287-3-RR, REG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe REG (84287-3-RR) by Proteintech is a Recombinant antibody targeting REG in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n84287-3-RR targets REG in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse stomach tissue\nPositive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Reg gene family is a multigene family grouped into four subclasses, types I, II, III and IV, based on the primary structures of the encoded proteins. This gene encodes a protein that is secreted by the exocrine pancreas. It is associated with islet cell regeneration and diabetogenesis and may be involved in pancreatic lithogenesis. It's reported that REG1A was significantly upregulated in tumor specimens and adenoma as compared to normal colorectal tissue. (PMID: 34698109)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag8640 Product name: Recombinant human REG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-166 aa of BC005350 Sequence: MAQTSSYFMLISCLMFLSQSQGQEAQTELPQARISCPEGTNAYRSYCYYFNEDRETWVDADLYCQNMNSGNLVSVLTQAEGAFVASLIKESGTDDFNVWIGLHDPKKNRRWHWSSGSLVSYKSWGIGAPSSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCKFKN Predict reactive species\nFull Name: regenerating islet-derived 1 alpha\nCalculated Molecular Weight: 166 aa, 19 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC005350\nGene Symbol: REG\nGene ID (NCBI): 5967\nRRID: AB_3671833\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P05451\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888360181929,"sku":"84287-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84287-3-rr","provider":"Iright","version":"1.0","type":"link"}