{"product_id":"proteintech-84306-4-rr","title":"Proteintech, 84306-4-RR, MAP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MAP2 (84306-4-RR) by Proteintech is a Recombinant antibody targeting MAP2 in WB, IF\/ICC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n84306-4-RR targets MAP2 in WB, IF\/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, U-251 cells\nPositive IF-P detected in: rat brain tissue, mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)-P: IF-P : 1:105-1:420\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAP2 (microtubule-associated protein 2) is a cytoskeleton protein abundant in the brain and has an important role in neuronal morphogenesis. Multiple high MW and low MW MAP2 isoforms are expressed within the proximal segment of axons, dendrites, and cell bodies. The expression of MAP2 is regulated in both a tissue- and developmentally-specific manner. The 280 kDa MAP2B is present throughout rat brain development, and the slightly larger MAP2A appears first during the end of the second week of postnatal life. MAP2C, composed of several bands of about 70 kDa, is present during early brain development and largely disappears from the mature brain except for the retina, olfactory bulb, and cerebellum. In addition, some isoforms with lower MW around 50-60 kDa also exist. MAP2 antibodies have been widely used to mark the neuron or dendrite formation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag11580 Product name: Recombinant human MAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 213-559 aa of BC038857 Sequence: TSAGSTDRLPYSKSGNKDGVTKSPEKRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVRILNKKIDFSKVQSRCGSKDNIKHSAGGGNVQIVTKKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL Predict reactive species\nFull Name: microtubule-associated protein 2\nCalculated Molecular Weight: 200 kDa\nObserved Molecular Weight: 280-300 kDa, 70-85 kDa\nGenBank Accession Number: BC038857\nGene Symbol: MAP2\nGene ID (NCBI): 4133\nRRID: AB_3671847\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P11137\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888434499753,"sku":"84306-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84306-4-rr","provider":"Iright","version":"1.0","type":"link"}