Proteintech, 84338-6-RR, ZNF148 Recombinant monoclonal antibody

Size: 20ul / 100ul The ZNF148 (84338-6-RR) by Proteintech is a Recombinant antibody targeting ZNF148 in WB, IF/ICC, ELISA applications with reactivity to human samples 84338-6-RR targets ZNF148 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag35742 Product name: Recombinant human ZNF148 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 611-794 aa of BC035591 Sequence: QALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG Predict reactive species Full Name: zinc finger protein 148 GenBank Accession Number: BC035591 Gene Symbol: ZNF148 Gene ID (NCBI): 7707 RRID: AB_3671878 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UQR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.