{"product_id":"proteintech-84338-7-rr","title":"Proteintech, 84338-7-RR, ZNF148 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ZNF148 (84338-7-RR) by Proteintech is a Recombinant antibody targeting ZNF148 in WB, ELISA applications with reactivity to human samples\n84338-7-RR targets ZNF148 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, T-47D cells,  HCT 116 cells,  HeLa cells,  MDA-MB-231 cells,  HepG2 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Kruppel-like zinc finger protein 148 (ZNF148), also known as β enolase repressor factor 1 (BERF1, ZBP-89, and BFCOL1), encoded by this gene is a member of the Kruppel family of zinc finger DNA binding proteins. ZNF148 participates in the regulation of cell proliferation and death, and is expressed at lower levels in mammalian somatic cells, and highly expressed in tumor cells. Previous studies show that there was a significant correlation between ZNF148 expression and the invasion and metastasis of colorectal tumors. ZNF148 has two alternative splicing isoforms, which are ZNF148FL and ZNF148ΔN. ZNF148FL contains a complete 794 amino acids, ZNF148ΔN lacks the amino-terminal 129 amino acids, and the mechanisms involved in the generation of these two splicing isoforms are not yet clear (PMID: 30463804). Thus, ZNF148 can be observed to have two molecular weights near 103 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35742 Product name: Recombinant human ZNF148 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 611-794 aa of BC035591 Sequence: QALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG Predict reactive species\nFull Name: zinc finger protein 148\nObserved Molecular Weight: 103 kDa\nGenBank Accession Number: BC035591\nGene Symbol: ZNF148\nGene ID (NCBI): 7707\nRRID: AB_3671879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UQR1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888681930921,"sku":"84338-7-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84338-7-rr","provider":"Iright","version":"1.0","type":"link"}