{"product_id":"proteintech-84341-3-rr","title":"Proteintech, 84341-3-RR, CD33 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CD33 (84341-3-RR) by Proteintech is a Recombinant antibody targeting CD33 in WB, IHC, ELISA applications with reactivity to human samples\n84341-3-RR targets CD33 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, K-562 cells,  U-937 cells,  HL-60 cells\nPositive IHC detected in: human tonsillitis tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD33, also referred to as Siglec-3, is a 67-kDa glycosylated transmembrane protein of sialic acid-binding immunoglobulin-like lactic (siglec) family. CD33 is expressed on monocytes, myeloid progenitors, granulocytes, mast cells, some T cells. It may mediate cell-to-cell adhesion and act as a receptor that inhibits the proliferation of normal and leukemic myeloid cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2138 Product name: Recombinant Human CD33 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 18-259 aa of BC028152 Sequence: DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH Predict reactive species\nFull Name: CD33 molecule\nCalculated Molecular Weight: 364 aa, 40 kDa\nObserved Molecular Weight: 55-75 kDa\nGenBank Accession Number: BC028152\nGene Symbol: CD33\nGene ID (NCBI): 945\nRRID: AB_3671882\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P20138\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888401961129,"sku":"84341-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84341-3-rr","provider":"Iright","version":"1.0","type":"link"}