{"product_id":"proteintech-84344-2-rr","title":"Proteintech, 84344-2-RR, EPPK1 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe EPPK1 (84344-2-RR) by Proteintech is a Recombinant antibody targeting EPPK1 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84344-2-RR targets EPPK1 in WB, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: MCF-7 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEpplakin 1 (EPPK1), belonging to the plakin family, is involved in connecting intermediate filaments and regulating their reorganization in stress response. Studies have shown that EPPK1 is involved in the progression of various cancers, such as liver cancer, cervical cancer, and bladder urothelial carcinoma.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35749 Product name: Recombinant human EPPK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1400-1570 aa of NM_031308.3 Sequence: NKFFFDPSARDQVTYQQLRERCVCDSETGLLLLPLPSDTVLEVDDHTAVALRAMKVPVSTGRFKGCSVSLWDLLLSEYVGADKRRELVALCRSGRAAALRQVVSAVTTLVEAAERQPLQATFRGLRKQVSARDLFRAQLISRKTLDELSQGTTTVKEVAEMDSVKRSLEGG Predict reactive species\nFull Name: epiplakin 1\nCalculated Molecular Weight: 555 kDa\nObserved Molecular Weight: 500-600 kDa\nGenBank Accession Number: NM_031308.3\nGene Symbol: EPPK1\nGene ID (NCBI): 83481\nRRID: AB_3671884\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P58107\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888742092969,"sku":"84344-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84344-2-rr","provider":"Iright","version":"1.0","type":"link"}