{"product_id":"proteintech-84361-2-rr","title":"Proteintech, 84361-2-RR, Placental lactogen Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe Placental lactogen (84361-2-RR) by Proteintech is a Recombinant antibody targeting Placental lactogen in WB, IHC, ELISA applications with reactivity to human samples\n84361-2-RR targets Placental lactogen in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChorionic somatomammotropin hormone 1 (placental lactogen, CSH1), is a hormone with the molecular weight of 25 kDa. The data suggest that this protein may link with the Silver-Russell syndrome (SRS), a disease of pre- and postnatal growth restriction and a characteristic small, triangular face. SRS is also accompanied by other dysmorphic features including fifth finger clinodactyly and skeletal asymmetry.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0201 Product name: Recombinant human CSH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-207 aa of BC002717 Sequence: RTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQ Predict reactive species\nFull Name: chorionic somatomammotropin hormone 1 (placental lactogen)\nCalculated Molecular Weight: 25 kDa\nObserved Molecular Weight: 20-25 kDa\nGenBank Accession Number: BC002717\nGene Symbol: CSH1\nGene ID (NCBI): 1442\nRRID: AB_3671899\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P0DML2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888658239657,"sku":"84361-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84361-2-rr","provider":"Iright","version":"1.0","type":"link"}