{"product_id":"proteintech-84371-2-rr","title":"Proteintech, 84371-2-RR, FNIP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FNIP2 (84371-2-RR) by Proteintech is a Recombinant antibody targeting FNIP2 in WB, ELISA applications with reactivity to human samples\n84371-2-RR targets FNIP2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  MDA-MB-231 cells,  MDA-MB-453 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFolliculin (FLCN)-interacting proteins 1 and 2 (FNIP1, FNIP2) are homologous binding partners of FLCN, a tumor suppressor for kidney cancer.  FNIP2 was found to bind to the C terminus of FLCN and to AMPK, like FNIP1. FNIP2 competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PMID: 18403135).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35014 Product name: Recombinant human FNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 740-885 aa of BC166693 Sequence: ERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEG Predict reactive species\nFull Name: folliculin interacting protein 2\nObserved Molecular Weight: 125 kda\nGenBank Accession Number: BC166693\nGene Symbol: FNIP2\nGene ID (NCBI): 57600\nRRID: AB_3671906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9P278\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888752644265,"sku":"84371-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84371-2-rr","provider":"Iright","version":"1.0","type":"link"}