{"product_id":"proteintech-84399-3-rr","title":"Proteintech, 84399-3-RR, PURG Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe PURG (84399-3-RR) by Proteintech is a Recombinant antibody targeting PURG in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84399-3-RR targets PURG in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPURG (Purine-rich element-binding protein G) is a member of the PUR protein family. It has 2 isoforms with a molecular weight of 37-40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag15820 Product name: Recombinant human PURG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-182 aa of BC106708 Sequence: HYAHLGLKGHRQEHGHSKEQGSRRRQKHSAPSPPVSVGSEEHPHSVLKTDYIERDNRK Predict reactive species\nFull Name: purine-rich element binding protein G\nCalculated Molecular Weight: 347 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC106708\nGene Symbol: PURG\nGene ID (NCBI): 29942\nRRID: AB_3671929\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9UJV8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888440299689,"sku":"84399-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84399-3-rr","provider":"Iright","version":"1.0","type":"link"}