Product Description
Size: 20ul / 100ul
The NeuN (84401-4-RR) by Proteintech is a Recombinant antibody targeting NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig samples
84401-4-RR targets NeuN in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
Tested Applications
Positive WB detected in: mouse cerebellum tissue, pig brain tissue, rat cerebellum tissue, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: rat brain tissue, mouse cerebellum tissue, mouse brain tissue
Positive IF-Fro detected in: mouse brain tissue
Recommended dilution
Western Blot (WB): WB : 1:5000-1:50000
Immunohistochemistry (IHC): IHC : 1:3000-1:12000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800
Specification
Tested Reactivity: human, mouse, rat, pig
Host / Isotype: Rabbit / IgG
Class: Recombinant
Type: Antibody
Immunogen: CatNo: Ag25689 Product name: Recombinant human NeuN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_001082575 Sequence: MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGTQTVPQTDEAAQTDSQPLHPSDPTEKQQPKR Predict reactive species
Full Name: hexaribonucleotide binding protein 3
Observed Molecular Weight: 46-52 kDa
GenBank Accession Number: NM_001082575
Gene Symbol: NeuN
Gene ID (NCBI): 146713
RRID: AB_3671930
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purfication
UNIPROT ID: A6NFN3
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924