{"product_id":"proteintech-84404-1-rr","title":"Proteintech, 84404-1-RR, LRRC2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe LRRC2 (84404-1-RR) by Proteintech is a Recombinant antibody targeting LRRC2 in IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84404-1-RR targets LRRC2 in IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U-251 cells\nPositive FC (Intra) detected in: U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLeucine Rich Repeat Containing 2 (LRRC2) was found to be localized to the mitochondria in human cells and transcriptionally regulated by the mitochondrial master regulator Pgc-1α. It has been reported that Lrrc2 transcript abundance correlates with that of β-MHC, a canonical marker of cardiac hypertrophy in humans, and experimentally demonstrated an elevation in Lrrc2 transcript in vitro and in vivo rodent models of cardiac hypertrophy as well as in patients with dilated cardiomyopathy. (PMID: 28158196)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag27830 Product name: Recombinant human LRRC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-200 aa of BC029118 Sequence: ETRVKKHKAWQKKEVERLEKSALEKIKEEWNFVAECRRKGIPQAVYCKNGFIDTSVRLLDKIERNTLTRQSSLPKDRGKRSSAFVFELSGEHWTELPDSLKEQTHLREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN Predict reactive species\nFull Name: leucine rich repeat containing 2\nCalculated Molecular Weight: 371 aa, 43 kDa\nGenBank Accession Number: BC029118\nGene Symbol: LRRC2\nGene ID (NCBI): 79442\nRRID: AB_3671933\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9BYS8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888777318569,"sku":"84404-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84404-1-rr","provider":"Iright","version":"1.0","type":"link"}