{"product_id":"proteintech-84444-1-rr","title":"Proteintech, 84444-1-RR, ACSM5 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ACSM5 (84444-1-RR) by Proteintech is a Recombinant antibody targeting ACSM5 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84444-1-RR targets ACSM5 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver tissue,  human kidney tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nACSM5(Acyl-CoA synthetase medium-chain family member 5) is also named as MACS3 and belongs to the ATP-dependent AMP-binding enzyme family. ACSM5 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). This protein has 2 isoforms produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag9373 Product name: Recombinant human ACSM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC016703 Sequence: MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYFNFAHDVLDVWSRLEEAGHRPPNPAFWWVNGTGAEIKWSFEELGKQSRKAANVLGGACGLQPGDRMMLVLPRLPEWWLVSVACMRTGTVVIPGVTQLTEKDLKYRLQASRAKSIITSDSLAPRVDAISAECPSLQTKLLVSDSSRPGWLNFRELLR Predict reactive species\nFull Name: acyl-CoA synthetase medium-chain family member 5\nCalculated Molecular Weight: 208 aa, 23 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: BC016703\nGene Symbol: ACSM5\nGene ID (NCBI): 54988\nRRID: AB_3671969\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q6NUN0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888350810281,"sku":"84444-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84444-1-rr","provider":"Iright","version":"1.0","type":"link"}