{"product_id":"proteintech-84485-5-rr","title":"Proteintech, 84485-5-RR, CKAP4 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CKAP4 (84485-5-RR) by Proteintech is a Recombinant antibody targeting CKAP4 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n84485-5-RR targets CKAP4 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HeLa cells,  A549 cells,  Caco-2 cells,  NIH\/3T3 cells\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCKAP4 (Cytoskeleton-associated protein 4), also known as CLIMP-63 (cytoskeleton-linking membrane protein 63), is a 63 kDa cytoskeleton-linking membrane protein. CKAP4 is a novel DKK1-binding protein on the cell surface membrane of Madin-Darby canine kidney (MDCK) epithelial cells, and evaluated CKAP4-mediated DKK1 signaling in cancer cell proliferation (PMID: 27322059). In addition, CKAP4 was modified with palmitate at Cys100 by palmitoyl acyltransferase DHHC2 (PMID: 18296695), and palmitoylation was required for CKAP4 localization to PM lipid rafts to promote cancer cell proliferation (PMID: 31744930).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag10022 Product name: Recombinant human CKAP4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 254-602 aa of BC082972 Sequence: IFTEVQKRSQKEINDMKAKVASLEESEGNKQDLKALKEAVKEIQTSAKSREWDMEALRSTLQTMESDIYTEVRELVSLKQEQQAFKEAADTERLALQALTEKLLRSEESVSRLPEEIRRLEEELRQLKSDSHGPKEDGGFRHSEAFEALQQKSQGLDSRLQHVEDGVLSMQVASARQTESLESLLSKSQEHEQRLAALQGRLEGLGSSEADQDGLASTVRSLGETQLVLYGDVEELKRSVGELPSTVESLQKVQEQVHTLLSQDQAQAARLPPQDFLDRLSSLDNLKASVSQVEADLKMLRTAVDSLVAYSVKIETNENNLESAKGLLDDLRNDLDRLFVKVEKIHEKV Predict reactive species\nFull Name: cytoskeleton-associated protein 4\nCalculated Molecular Weight: 602 aa, 66 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC082972\nGene Symbol: CKAP4\nGene ID (NCBI): 10970\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q07065\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888726462633,"sku":"84485-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84485-5-rr","provider":"Iright","version":"1.0","type":"link"}