Proteintech, 84499-1-RR, TMBIM6 Recombinant monoclonal antibody

Size: 20ul / 100ul The TMBIM6 (84499-1-RR) by Proteintech is a Recombinant antibody targeting TMBIM6 in IHC, IF-P, ELISA applications with reactivity to human, mouse samples 84499-1-RR targets TMBIM6 in IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse liver tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:125-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag24780 Product name: Recombinant human TMBIM6 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-86 aa of BC000916 Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG Predict reactive species Full Name: transmembrane BAX inhibitor motif containing 6 Calculated Molecular Weight: 27 kDa GenBank Accession Number: BC000916 Gene Symbol: TMBIM6 Gene ID (NCBI): 7009 RRID: AB_3672012 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P55061 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.