Iright
BRAND / VENDOR: Proteintech

Proteintech, 84516-7-RR, SAE1 Recombinant monoclonal antibody

CATALOG NUMBER: 84516-7-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The SAE1 (84516-7-RR) by Proteintech is a Recombinant antibody targeting SAE1 in WB, FC (Intra), ELISA applications with reactivity to human samples 84516-7-RR targets SAE1 in WB, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, A431 cells, HeLa cells, K-562 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information SAE1(SUMO-activating enzyme subunit 1) is also named as AOS1, SUA1, UBLE1A and belongs to the ubiquitin-activating E1 family. SAE1 has a calculated molecular mass of 38 kD. SAE1 and UBA2 form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins(PMID:9920803). Western blot analysis of synchronized HeLa cells detectes increased AOS1 expression as cells progressed through S phase, followed by a substantial decrease in G2 phase. Immunofluorescence analysis shows AOS1 and UBA2 distributed throughout nuclei, but they are excluded from nucleoli.(PMID:11481243). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag0275 Product name: Recombinant human SAE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC000344 Sequence: MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIVKVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMV Predict reactive species Full Name: SUMO1 activating enzyme subunit 1 Calculated Molecular Weight: 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000344 Gene Symbol: SAE1 Gene ID (NCBI): 10055 RRID: AB_3672023 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q9UBE0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924