Iright
BRAND / VENDOR: Proteintech

Proteintech, 84542-6-RR, UCHL3 Recombinant monoclonal antibody

CATALOG NUMBER: 84542-6-RR
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 100ul The UCHL3 (84542-6-RR) by Proteintech is a Recombinant antibody targeting UCHL3 in WB, IHC, ELISA applications with reactivity to human, rat samples 84542-6-RR targets UCHL3 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse spleen tissue, MCF-7 cells, Jurkat cells, SH-SY5Y cells, BxPC-3 cells, rat spleen tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information UCH-L3 belongs to the ubiquitin C-terminal hydrolase family that deubiquitinates ubiquitin-protein conjugates in the ubiquitin-proteasome system. This enzyme indirectly increases the phosphorylation of IGFIR, AKT, FOXO1 and promotes insulin-signaling and insulin-induced adipogenesis. It is required for stress-response retinal, skeletal muscle and germ cell maintenance and may be involved in working memory. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag3053 Product name: Recombinant human UCHL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-230 aa of BC018125 Sequence: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA Predict reactive species Full Name: ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC018125 Gene Symbol: UCHL3 Gene ID (NCBI): 7347 RRID: AB_3672047 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P15374 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924