{"product_id":"proteintech-84553-1-rr","title":"Proteintech, 84553-1-RR, ANP32CP Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ANP32CP (84553-1-RR) by Proteintech is a Recombinant antibody targeting ANP32CP in WB, IF\/ICC, ELISA applications with reactivity to human samples\n84553-1-RR targets ANP32CP in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, BxPC-3 cells,  LNCaP cells,  MCF-7 cells,  DU 145 cells\nPositive IF\/ICC detected in: LNCaP cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:125-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANP32CP (acidic nuclear phosphoprotein 32 family member C, pseudogene), also known as PP32R1. It is expected to be located in nucleus and perinuclear region of cytoplasm. Expressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. Not expressed in normal prostatic tissue (PMID: 10086381). The calculated molecular weight of ANP32CP is 27 kDa. The protein could be the product of a pseudogene. Gene encoding ANP32CP is intronless suggesting that is pseudogene generated by retrotransposition.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35293 Product name: Recombinant human ANP32CP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 141-234 aa of NM_012403.1 Sequence: LDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK Predict reactive species\nFull Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member C\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: NM_012403.1\nGene Symbol: ANP32C\/PP32R1\nGene ID (NCBI): 23520\nRRID: AB_3672061\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O43423\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888693301417,"sku":"84553-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84553-1-rr","provider":"Iright","version":"1.0","type":"link"}