Proteintech, 84577-4-RR, WNT3A Recombinant monoclonal antibody

Size: 20ul / 100ul The WNT3A (84577-4-RR) by Proteintech is a Recombinant antibody targeting WNT3A in IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 84577-4-RR targets WNT3A in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:125-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information WNT3A belongs to wingless-type MMTV integration site family, and abnormal Wnt signalling is often associated with severe human diseases, including cancer, osteoporosis and other degenerative disorders. WNT3A is a secreted glycoprotein that is involved in both canonical and non-canonical Wnt signaling pathways. The canonical Wnt pathway, also known as the β-catenin-dependent pathway, regulates gene expression by stabilizing β-catenin, which then translocates to the nucleus and interacts with transcription factors like TCF/LEF. It's shown to promote trophectoderm formation in embryonic stem cells. It's reported that the canonical Wnt/β-catenin signaling pathway also contributes to the carcinogenesis and progression of lung cancer cell lines. The non-canonical pathways, which are β-catenin-independent, are involved in cytoskeletal organization and cell polarity. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag25051 Product name: Recombinant human WNT3A protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 250-350 aa of BC103921 Sequence: RGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARAERRREKCRCVFHWCCYVSCQECTRVYDVHT Predict reactive species Full Name: wingless-type MMTV integration site family, member 3A Calculated Molecular Weight: 352 aa, 39 kDa GenBank Accession Number: BC103921 Gene Symbol: WNT3A Gene ID (NCBI): 89780 RRID: AB_3672077 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P56704 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.