{"product_id":"proteintech-84584-5-rr","title":"Proteintech, 84584-5-RR, BAP31 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe BAP31 (84584-5-RR) by Proteintech is a Recombinant antibody targeting BAP31 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n84584-5-RR targets BAP31 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  HeLa cells,  MCF-7 cells,  THP-1 cells,  mouse liver tissue,  rat liver tisssue\nPositive IHC detected in: human colon cancer tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\nPositive FC (Intra) detected in: HepG2 cells, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBAP31, also known as  BCAP31, is a chaperone protein abundant in the endoplasmic reticulum (ER). BAP31 plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded proteins, and their targeting to the ER-associated-degradation (ERAD). CDIP1 and BAP31 interact upon ER stress to regulate the mitochondrial apoptosis pathway(PMID: 24139803). It also serves as a cargo receptor for the export of transmembrane proteins. BAP31 may be involved in apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag1668 Product name: Recombinant human BCAP31 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-246 aa of BC014323 Sequence: MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIREYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE Predict reactive species\nFull Name: B-cell receptor-associated protein 31\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC014323\nGene Symbol: BAP31\nGene ID (NCBI): 10134\nRRID: AB_3672082\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P51572\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888344191145,"sku":"84584-5-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84584-5-rr","provider":"Iright","version":"1.0","type":"link"}