Proteintech, 84629-2-RR, Prostein Recombinant monoclonal antibody

Size: 20ul / 100ul The Prostein (84629-2-RR) by Proteintech is a Recombinant antibody targeting Prostein in IHC, ELISA applications with reactivity to human samples 84629-2-RR targets Prostein in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Prostein is a prostate tissue-specific protein whose expression is highly restricted to normal and cancerous prostate tissues. Anti-prostein is useful for the identification of prostate adenocarcinomas and is a good marker to identify prostatic origin in metastatic cancer. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag5463 Product name: Recombinant human SLC45A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 405-553 aa of BC050416 Sequence: REKQVFLPKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA Predict reactive species Full Name: solute carrier family 45, member 3 Calculated Molecular Weight: 59 kDa GenBank Accession Number: BC050416 Gene Symbol: Prostein Gene ID (NCBI): 85414 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96JT2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.