{"product_id":"proteintech-84656-4-rr","title":"Proteintech, 84656-4-RR, RXRB Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe RXRB (84656-4-RR) by Proteintech is a Recombinant antibody targeting RXRB in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n84656-4-RR targets RXRB in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SK-BR-3 cells, K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRetinoid X Receptor beta (RXRB) is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid. RXRB heterodimerizes with other nuclear hormone receptors, such as RAR, the thyroid hormone receptor, and the vitamin D3 receptor, to enhance binding to their cognate response elements. (PMID: 8257090)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0263 Product name: Recombinant human RXRB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-238 aa of BC001167 Sequence: RDGMGDSGRDSRSPDSSSPNPLPQGVPPPSPPGPPLPPSTAPSLGGSGAPPPPPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLT Predict reactive species\nFull Name: retinoid X receptor, beta\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC001167\nGene Symbol: RXRB\nGene ID (NCBI): 6257\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P28702\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888360607913,"sku":"84656-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84656-4-rr","provider":"Iright","version":"1.0","type":"link"}