{"product_id":"proteintech-84662-4-rr","title":"Proteintech, 84662-4-RR, FceR1a Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe FceR1a (84662-4-RR) by Proteintech is a Recombinant antibody targeting FceR1a in WB, ELISA applications with reactivity to human, mouse samples\n84662-4-RR targets FceR1a in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MC\/9 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFc epsilon Receptor I alpha (FceR1a) is a single-pass type I membrane protein that contains 2 immunoglobulin-like domains. FceR1a forms a tetrameric complex, FceRI, with one beta and two gamma subunits (PMID: 19406478). FceRI is the high-affinity receptor for the Fc region of immunoglobulin E (IgE) (PMID: 1532373). It is expressed on mast cells and basophils and plays a central role in the allergic response (PMID: 2148316). The calculated molecular weight of FceR1a is 30 kDa, the 55- to 70-kDa bands detected by this antibody are probably caused by heterogeneous glycosylation (PMID: 11344350; 12671054).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2022 Product name: Recombinant Human Fc Epsilon RI Alpha protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-205 aa of NM_001387280.1 Sequence: VPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVSSTKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAEVVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLDYESEPLNITVIKAPREKYWLQ Predict reactive species\nFull Name: Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_001387280.1\nGene Symbol: FceR1a\nGene ID (NCBI): 2205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P12319\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888745205929,"sku":"84662-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84662-4-rr","provider":"Iright","version":"1.0","type":"link"}