{"product_id":"proteintech-84663-1-rr","title":"Proteintech, 84663-1-RR, VRK2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe VRK2 (84663-1-RR) by Proteintech is a Recombinant antibody targeting VRK2 in WB, ELISA applications with reactivity to human samples\n84663-1-RR targets VRK2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U2OS cells, HepG2 cells,  HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVaccinia-related kinase 2 (VRK2) is a serine\/threonine kinase that plays a significant role in various cellular processes, including cell survival, proliferation, and DNA damage response. The VRK2 gene is known to produce two main splice variants: VRK2A and VRK2B, with VRK2A being the predominant form in humans. VRK2 is involved in several key biological functions. It is known to enhance cell survival by acting as an anti-apoptotic factor, which is particularly crucial in cancer biology. The overexpression of VRK2 has been linked to increased drug sensitivity in cancer cells, suggesting that this kinase may play a role in therapeutic responses. Additionally, high levels of VRK2 protein have been associated with improved survival rates in specific subgroups of astrocytomas, a type of brain tumor. (PMID:\n29872222; 37943248; 24079673)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag4019 Product name: Recombinant human VRK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC027854 Sequence: MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVVKVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMVMERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDVKAANLLLGYKNPDQVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCMLRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAYDEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVN Predict reactive species\nFull Name: vaccinia related kinase 2\nCalculated Molecular Weight: 508 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC027854\nGene Symbol: VRK2\nGene ID (NCBI): 7444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q86Y07\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888841674921,"sku":"84663-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84663-1-rr","provider":"Iright","version":"1.0","type":"link"}