{"product_id":"proteintech-84680-4-rr","title":"Proteintech, 84680-4-RR, ERMN Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe ERMN (84680-4-RR) by Proteintech is a Recombinant antibody targeting ERMN in WB, ELISA applications with reactivity to human, rat samples\n84680-4-RR targets ERMN in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERMN is associated with cytoskeletal rearrangements and the stability of myelin sheath. A study has shown that ERMN is expressed specifically in oligodendrocytes in the central nervous system (CNS), and is involved in the formation of myelin (PMID: 20934411). The predicted MW of ERMN is 33 KDa, while western blot analyses detected a 50 kDa single band protein as a result of phosphorylation modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag35648 Product name: Recombinant human ERMN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC026345 Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSR Predict reactive species\nFull Name: ermin, ERM-like protein\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC026345\nGene Symbol: ERMN\nGene ID (NCBI): 57471\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q8TAM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888613085353,"sku":"84680-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84680-4-rr","provider":"Iright","version":"1.0","type":"link"}