Proteintech, 84701-1-RR, CCL3/MIP-1 alpha Recombinant monoclonal antibody

Size: 20ul / 100ul The CCL3/MIP-1 alpha (84701-1-RR) by Proteintech is a Recombinant antibody targeting CCL3/MIP-1 alpha in IF/ICC, ELISA applications with reactivity to mouse samples 84701-1-RR targets CCL3/MIP-1 alpha in IF/ICC, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCL3, also known as macrophage inflammatory protein-1 alpha (MIP-1α), is a chemokine that plays a significant role in immune responses. It is involved in recruiting immune cells, particularly monocytes and T cells, to sites of inflammation and infection. CCL3 is produced by various cell types, including activated macrophages and lymphocytes, and is crucial for orchestrating the immune response to infections and tissue injury. In summary, CCL3 is a multifunctional chemokine that is essential for immune cell recruitment and plays a role in various diseases, including chronic inflammatory conditions and cancer. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Eg2170 Product name: Recombinant Mouse CCL3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011337 Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Predict reactive species Full Name: chemokine (C-C motif) ligand 3 Calculated Molecular Weight: 10kd GenBank Accession Number: NM_011337 Gene Symbol: Ccl3 Gene ID (NCBI): 20302 RRID: AB_3672117 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: P10855 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.