{"product_id":"proteintech-84701-1-rr","title":"Proteintech, 84701-1-RR, CCL3\/MIP-1 alpha Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe CCL3\/MIP-1 alpha (84701-1-RR) by Proteintech is a Recombinant antibody targeting CCL3\/MIP-1 alpha in IF\/ICC, ELISA applications with reactivity to mouse samples\n84701-1-RR targets CCL3\/MIP-1 alpha in IF\/ICC, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL3, also known as macrophage inflammatory protein-1 alpha (MIP-1α), is a chemokine that plays a significant role in immune responses. It is involved in recruiting immune cells, particularly monocytes and T cells, to sites of inflammation and infection. CCL3 is produced by various cell types, including activated macrophages and lymphocytes, and is crucial for orchestrating the immune response to infections and tissue injury. In summary, CCL3 is a multifunctional chemokine that is essential for immune cell recruitment and plays a role in various diseases, including chronic inflammatory conditions and cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2170 Product name: Recombinant Mouse CCL3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-92 aa of NM_011337 Sequence: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA Predict reactive species\nFull Name: chemokine (C-C motif) ligand 3\nCalculated Molecular Weight: 10kd\nGenBank Accession Number: NM_011337\nGene Symbol: Ccl3\nGene ID (NCBI): 20302\nRRID: AB_3672117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P10855\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888868708521,"sku":"84701-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84701-1-rr","provider":"Iright","version":"1.0","type":"link"}