{"product_id":"proteintech-84703-3-rr","title":"Proteintech, 84703-3-RR, APLP2 Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe APLP2 (84703-3-RR) by Proteintech is a Recombinant antibody targeting APLP2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84703-3-RR targets APLP2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, mouse brain tissue,  SH-SY5Y cells,  HEK-293 cells\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAmyloid precursor-like protein-2 (APLP2) is a member of the APP (amyloid precursor protein) family including APP, APLP1, and APLP2. APLP2  is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI\/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. APLP2 has been shown to regulate multiple cellular functions such as neurite outgrowth, axogenesis, corneal epithelial wound healing, cell adhesion, migration, and mitosis. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. APLP2 has been implicated in the pathogenesis of Alzheimer's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag6842 Product name: Recombinant human APLP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 33-360 aa of BC000373 Sequence: YIEALAANAGTGFAVAEPQIAMFCGKLNMHVNIQTGKWEPDPTGTKSCFETKEEVLQYCQEMYPELQITNVMEANQRVSIDNWCRRDKKQCKSRFVTPFKCLVGEFVSDVLLVPEKCQFFHKERMEVCENHQHWHTVVKEACLTQGMTLYSYGMLLPCGVDQFHGTEYVCCPQTKIIGSVSKEEEEEDEEEEEEEDEEEDYDVYKSEFPTEADLEDFTEAAVDEDDEDEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAVCSQEAMTGPCRAVMPRWYFDLSKGKCVRFIYGGCGGNRNNFESEDYCMAVC Predict reactive species\nFull Name: amyloid beta (A4) precursor-like protein 2\nCalculated Molecular Weight: 87 kDa\nObserved Molecular Weight: 95-120 kDa\nGenBank Accession Number: BC000373\nGene Symbol: APLP2\nGene ID (NCBI): 334\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q06481\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888589000873,"sku":"84703-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84703-3-rr","provider":"Iright","version":"1.0","type":"link"}