{"product_id":"proteintech-84729-4-rr","title":"Proteintech, 84729-4-RR, MECR Recombinant monoclonal antibody","description":"Size: 20ul \/ 100ul\nThe MECR (84729-4-RR) by Proteintech is a Recombinant antibody targeting MECR in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n84729-4-RR targets MECR in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, HeLa cells,  mouse heart tissue,  rat heart tissue,  mouse stomach tissue\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells, C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial 2-enoyl-acyl-carrier protein reductase (MECR) is an enzyme in the mitochondrial fatty acid synthase (mtFAS) pathway. MECR is involved in the synthesis of lipoic acid and is required for mitochondrial respiratory competence. MECR is highly expressed in skeletal and heart muscles and exhibits lower expression in placenta, liver, kidney, and pancreas. It is weakly expressed or not expressed in the lung (PMID: 32440681, PMID: 37734847, PMID: 38296034).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag0465 Product name: Recombinant mouse Mecr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-373 aa of BC003864 Sequence: SSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM Predict reactive species\nFull Name: mitochondrial trans-2-enoyl-CoA reductase\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC003864\nGene Symbol: MECR\nGene ID (NCBI): 26922\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9DCS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888782037161,"sku":"84729-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-84729-4-rr","provider":"Iright","version":"1.0","type":"link"}