Proteintech, 84742-1-RR, SC4MOL Recombinant monoclonal antibody

Size: 20ul / 100ul The SC4MOL (84742-1-RR) by Proteintech is a Recombinant antibody targeting SC4MOL in WB, ELISA applications with reactivity to human, mouse samples 84742-1-RR targets SC4MOL in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse adipose tissue, mouse liver tissue, mouse small intestine tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information SC4MOL(sterol C4-methyl oxidase-like), an intermediate enzyme in the cholesterol biosynthetic pathway, was included in the library based on its representation in a high confidence GEO transcriptional profiling dataset as a transcript that rapidly undergoes significant expression change in response to stimulation or inhibition of EGFR. Among the validated hits that increased cell killing by common EGFR antagonists, SC4MOL was consistently one of the most effective modulators. (PMID: 23125191) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag34758 Product name: Recombinant human SC4MOL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-293 aa of BC107879 Sequence: LLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE Predict reactive species Full Name: sterol-C4-methyl oxidase-like Observed Molecular Weight: 36 kDa GenBank Accession Number: BC107879 Gene Symbol: SC4MOL Gene ID (NCBI): 6307 RRID: AB_3672127 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q15800 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.