Proteintech, 84757-3-RR, RB1CC1 Recombinant monoclonal antibody

Size: 20ul / 100ul The RB1CC1 (84757-3-RR) by Proteintech is a Recombinant antibody targeting RB1CC1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 84757-3-RR targets RB1CC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information RB1CC1, also named as RBICC, is implicated in the regulation of RB1 expression and functions as a DNA-binding transcription factor. It is a potent regulator of the RB1 pathway and a mediator that plays a crucial role in muscular differentiation. Its expression is, thus, a prerequisite for myogenic differentiation. Involved in autophagy. RB1CC1 is required for autophagosome formation. It is probably involved in the tumorigenesis of breast cancer. RB1CC1 is frequently mutated in breast cancer and shows characteristics of a classical tumor suppressor gene. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag10508 Product name: Recombinant human RB1CC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1241-1594 aa of BC017556 Sequence: AIQTALKEFKLEREVVEKELLEKVKHLENQIAKSPAIDSTRGDSSSLVAELQEKLQEEKAKFLEQLEEQEKRKNEEMQNVRTSLIAEQQTNFNTVLTREKMRKENIINDLSDKLKSTMQQQERDKDLIESLSEDRARLLEEKKKLEEEVSKLRSSSFVPSPYVATAPELYGACAPELPGESDRSAVETADEGRVDSAMETSMMSVQENIHMLSEEKQRIMLLERTLQLKEEENKRLNQRLMSQSMSSVSSRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV Predict reactive species Full Name: RB1-inducible coiled-coil 1 Calculated Molecular Weight: 1594 aa, 183 kDa Observed Molecular Weight: 220 kDa GenBank Accession Number: BC017556 Gene Symbol: RB1CC1 Gene ID (NCBI): 9821 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purfication UNIPROT ID: Q8TDY2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.