Proteintech, 84761-2-RR, SPTAN1 Recombinant monoclonal antibody

Size: 20ul / 100ul The SPTAN1 (84761-2-RR) by Proteintech is a Recombinant antibody targeting SPTAN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 84761-2-RR targets SPTAN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: 3T3-L1 cells, HeLa cells, mouse brain tissue, Jurkat cells, MDA-MB-231 cells, rat brain tissue Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SPTAN1 (Nonerythroid spectrin αII), also termed α-Fodrin, is a cytoskeletal protein that belongs to the family of spectrins. Spectrins includes several structural proteins (α- and β-spectrin, α-actinin, dystrophin, and utrophin) that build and stabilize the cytoskeleton by forming a hexagonal mesh under the plasma membrane and ensuring stability and organization of organelles in the cell. SPTAN1 encodes for a 2,472 amino acid protein with a predicted molecular weight of 284 kDa and can be cleaved by calpain leading to a 150 kDa fragment (PMID: 31186638). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Recombinant Type: Antibody Immunogen: CatNo: Ag36472 Product name: Recombinant human SPTAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2315-2472 aa of NM_003127.3 Sequence: RNTTGVTEEALKEFSMMFKHFDKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAFDYVEFTRSLFVN Predict reactive species Full Name: spectrin, alpha, non-erythrocytic 1 (alpha-fodrin) Calculated Molecular Weight: 285kDa，2472aa Observed Molecular Weight: 285 kDa,150 kDa GenBank Accession Number: NM_003127.3 Gene Symbol: SPTAN1 Gene ID (NCBI): 6709 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13813 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.